PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001255569.1 to PF15249 (GLTSCR1)

NP_001255569.1 has 1607 amino acids

Query:       GLTSCR1  [M=102]
Accession:   PF15249.10
Description: Conserved region of unknown function on GLTSCR protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.1e-19   54.5   0.8    7.1e-19   54.5   0.8    3.1  4  NP_001255569.1  


Domain annotation for each sequence (and alignments):
>> NP_001255569.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.3   0.1      0.71      0.71      27      41 ..      91     105 ..      90     115 .. 0.73
   2 ?   -2.0   0.2      0.29      0.29      48      82 ..     216     250 ..     198     294 .. 0.65
   3 ?   -3.6   0.0      0.91      0.91      58      77 ..     412     431 ..     407     437 .. 0.83
   4 !   54.5   0.8   7.1e-19   7.1e-19      10     101 ..     694     782 ..     685     783 .. 0.93

  Alignments for each domain:
  == domain 1  score: -3.3 bits;  conditional E-value: 0.71
         GLTSCR1  27 YHvfqepkedeedle 41 
                     YHv+q+++   + ++
  NP_001255569.1  91 YHVMQNNDSFAQHMQ 105
                     9****9887666555 PP

  == domain 2  score: -2.0 bits;  conditional E-value: 0.29
         GLTSCR1  48 ekvatellkrfqkllnkyrrlllreskrespseee 82 
                     +k+a +  +++ + l k+++l+++ ++++ ++e++
  NP_001255569.1 216 KKTAAQAPDTVGTVLTKVNKLTQQIDNNNDNQEQK 250
                     55666666666666666666666665544444443 PP

  == domain 3  score: -3.6 bits;  conditional E-value: 0.91
         GLTSCR1  58 fqkllnkyrrlllreskres 77 
                     +q+++n yr+   +es+++ 
  NP_001255569.1 412 QQQQYNDYRQPPSQESMQYG 431
                     68999999999999999765 PP

  == domain 4  score: 54.5 bits;  conditional E-value: 7.1e-19
         GLTSCR1  10 vktpFasleDAvkRLlPYHvfqepkedeedlekadeefekvatellkrfqkllnkyrrlllreskrespseeevmlerllleeeraeleelk 101
                       tpF+++ D+++RLlPYH+f++++e  +d++   + f++v+++ + +++ + n+ r+++lr+ +r+s   ee m+  l +e+er++le++k
  NP_001255569.1 694 DVTPFRNKMDVLERLLPYHHFANEEEPVSDFD---STFQRVMDNAVHQANSIGNRIRNIVLRDTMRSSTEWEENMILFLETESERRKLEDDK 782
                     468***********************999987...89***************************************9999*********988 PP



Or compare NP_001255569.1 to CDD or PaperBLAST