NP_001260098.1 has 126 amino acids
Query: TXD17-like_Trx [M=119] Accession: PF06110.15 Description: Thioredoxin domain-containing protein 17-like, thioredoxin domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-60 188.7 0.0 1.4e-60 188.5 0.0 1.0 1 NP_001260098.1 Domain annotation for each sequence (and alignments): >> NP_001260098.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 188.5 0.0 1.4e-60 1.4e-60 1 119 [] 6 124 .. 6 124 .. 0.99 Alignments for each domain: == domain 1 score: 188.5 bits; conditional E-value: 1.4e-60 TXD17-like_Trx 1 svkgfeefekkvkelekesktvfilFsgekdteGesWCPdCvkaepvieealkeapedvklvvvdvGdrevWkdpanefRkdpklkltavPtLlr 95 +vkg++ef+kk++ele+++++v++lFsg+kd++GesWCP+Cvkaepvi++alk+ap ++++v+vdvG+r++Wkd +++fRkdp+++l+++PtLlr NP_001260098.1 6 NVKGYDEFTKKMEELENGDEPVHVLFSGGKDEKGESWCPYCVKAEPVIHDALKKAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLR 100 589******************************************************************************************** PP TXD17-like_Trx 96 wkgkkrLeeeqllkssLvellfee 119 wk+++rL++e++++++Lve++fe+ NP_001260098.1 101 WKRPQRLDGERCSNQDLVEMMFED 124 **********************96 PP
Or compare NP_001260098.1 to CDD or PaperBLAST