NP_001291476.1 has 181 amino acids
Query: DUF2464 [M=253] Accession: PF10240.13 Description: Multivesicular body subunit 12 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-48 151.0 0.0 2.6e-48 150.9 0.0 1.0 1 NP_001291476.1 Domain annotation for each sequence (and alignments): >> NP_001291476.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.9 0.0 2.6e-48 2.6e-48 83 253 .] 1 169 [. 1 169 [. 0.95 Alignments for each domain: == domain 1 score: 150.9 bits; conditional E-value: 2.6e-48 DUF2464 83 lDskekalrKkrlcvklsprgsaetAvtDiillskskkapegytlvGeingllvcykkgaiskskpqakprsvslelkslsleespsrpapkepl 177 +Dsk+++++Kkr+cvkl p g+++tAv+D++l++k+k++p gy +G+++g+++++kk + ++p +kpr +s +++ lsl+ + +p++ l NP_001291476.1 1 MDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVP-GYLRIGDMGGFAIWCKKAKA--PRPVPKPRGLSRDMQGLSLDAAS-QPSKGGLL 91 79**************************************.******************99..77799**************8888.78888888 PP DUF2464 178 sksstarrstlra.kksdseaesstlygisaldGVpFvlnpkfekskkss.qssqlpdikikslaeiekeynYdFave 253 ++++++ +s+ ++ +++ds +e+s+lygisa+dGVpF+l+p+fe ++ s ++s++ d++iksla+ie+eynY F ve NP_001291476.1 92 ERTASRLGSRASTlRRNDSIYEASSLYGISAMDGVPFTLHPRFEGKSCSPlAFSAFGDLTIKSLADIEEEYNYGFVVE 169 8888888888888899******************************999989***********************998 PP
Or compare NP_001291476.1 to CDD or PaperBLAST