NP_001291890.1 has 314 amino acids
Query: CCDC92 [M=57] Accession: PF14916.10 Description: Coiled-coil domain of unknown function Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-28 84.3 10.2 4e-27 80.2 3.2 2.6 2 NP_001291890.1 Domain annotation for each sequence (and alignments): >> NP_001291890.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.2 3.2 4e-27 4e-27 1 55 [. 7 61 .. 7 63 .. 0.95 2 ! 7.9 0.7 0.00015 0.00015 31 50 .. 66 85 .. 65 92 .. 0.91 Alignments for each domain: == domain 1 score: 80.2 bits; conditional E-value: 4e-27 CCDC92 1 eqrvqsleksikFLqeqhaatLkgLHkEIerLqkrnkdLtfklvmkegesskkgs 55 e++++s++k+++FLq++ha tLkgLH+EI+rLq++++dLt++l++k++e++ +g NP_001291890.1 7 ENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCTDLTYELTVKSSEQTGDGT 61 68**********************************************9988775 PP == domain 2 score: 7.9 bits; conditional E-value: 0.00015 CCDC92 31 rLqkrnkdLtfklvmkeges 50 +L+kr+ +L+ +l +ke e+ NP_001291890.1 66 ELKKRCEELEAQLKVKENEN 85 69**************9998 PP
Or compare NP_001291890.1 to CDD or PaperBLAST