NP_001307129.1 has 450 amino acids
Query: DUF3493 [M=79]
Accession: PF11998.13
Description: Low psii accumulation1 / Rep27
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.1e-30 89.0 0.4 2.3e-29 87.8 0.4 1.7 1 NP_001307129.1
Domain annotation for each sequence (and alignments):
>> NP_001307129.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.8 0.4 2.3e-29 2.3e-29 2 79 .] 181 258 .. 180 258 .. 0.97
Alignments for each domain:
== domain 1 score: 87.8 bits; conditional E-value: 2.3e-29
DUF3493 2 ekkarLraEakaPfRglRlflYlafaaSaliGalifllrllagrsgaesapeleetlqnlaiqvgvvalmvfLlrler 79
+++ +L +E++aPfRg+R+f+Y+a++a+a+i+++++++rl+ + +g+++ap+l et n ai++g+++++v+L+++e+
NP_001307129.1 181 RRDLKLISEVQAPFRGVRRFFYVALTAAAGISTFFTIPRLVLAVRGGDGAPDLLETAGNAAINIGGIVVLVALYFWEN 258
5788************************************************************************96 PP
Or compare NP_001307129.1 to CDD or PaperBLAST