NP_001309261.1 has 109 amino acids
Query: DUF2340 [M=120] Accession: PF10209.13 Description: Uncharacterized conserved protein (DUF2340) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-38 117.9 2.9 2.9e-27 81.7 0.4 2.0 2 NP_001309261.1 Domain annotation for each sequence (and alignments): >> NP_001309261.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.3 0.2 8.4e-14 8.4e-14 1 38 [. 8 44 .. 8 45 .. 0.94 2 ! 81.7 0.4 2.9e-27 2.9e-27 53 120 .] 43 109 .] 41 109 .] 0.96 Alignments for each domain: == domain 1 score: 38.3 bits; conditional E-value: 8.4e-14 DUF2340 1 ltvRviksfeyRnvknlvlkdvdlkettvkdllelvke 38 +tvR+i+sfe+Rn+k +v+++v+l ++tvk+++ +k+ NP_001309261.1 8 ITVRLIRSFEHRNFKPVVYHGVNL-DQTVKEFIVFLKQ 44 8***********************.*******988776 PP == domain 2 score: 81.7 bits; conditional E-value: 2.9e-27 DUF2340 53 eydtlKiytkahgskttnlvinldddeklilkdeektLaelgvenEtelslFnredYeefkanpeekw 120 + d+lKi+++ah+skt++lv++l+dde+l+lk+ ++tL+++g+++Ete+++F++edY+++kanp ++w NP_001309261.1 43 KQDALKIIHQAHKSKTNELVLSLEDDERLLLKE-DSTLKAAGIASETEIAFFCEEDYKNYKANPISSW 109 569************************999999.******************************9998 PP
Or compare NP_001309261.1 to CDD or PaperBLAST