PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001320551.1 to PF11961 (DUF3475)

NP_001320551.1 has 615 amino acids

Query:       DUF3475  [M=57]
Accession:   PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-25   74.7   1.3    7.5e-25   73.1   1.3    1.9  1  NP_001320551.1  


Domain annotation for each sequence (and alignments):
>> NP_001320551.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   73.1   1.3   7.5e-25   7.5e-25       1      57 []     136     192 ..     136     192 .. 0.99

  Alignments for each domain:
  == domain 1  score: 73.1 bits;  conditional E-value: 7.5e-25
         DUF3475   1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57 
                     iLAFEvAn+++K++ L+qsLs+++++ +++++l+se VkkLvS+D+++L  La+++k
  NP_001320551.1 136 ILAFEVANTIAKGAALLQSLSEENLKFMKKDMLHSEEVKKLVSTDTTELQILAASDK 192
                     9*****************************************************996 PP



Or compare NP_001320551.1 to CDD or PaperBLAST