NP_001331590.1 has 471 amino acids
Query: DUF3475 [M=57]
Accession: PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.1e-28 82.5 2.2 1.4e-27 81.8 0.4 2.4 3 NP_001331590.1
Domain annotation for each sequence (and alignments):
>> NP_001331590.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.8 0.4 1.4e-27 1.4e-27 1 57 [] 151 207 .. 151 207 .. 0.99
2 ? -2.8 0.0 0.38 0.38 25 38 .. 318 331 .. 315 338 .. 0.76
3 ? -2.6 0.0 0.33 0.33 9 20 .. 334 345 .. 330 346 .. 0.87
Alignments for each domain:
== domain 1 score: 81.8 bits; conditional E-value: 1.4e-27
DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57
iLAFEvAn+++K +L++sLs++++++L+ il seGV++LvS+D ++LlrL++a+k
NP_001331590.1 151 ILAFEVANTIVKSSNLIESLSKRNIEHLKGTILYSEGVQNLVSNDFDELLRLVAADK 207
9******************************************************97 PP
== domain 2 score: -2.8 bits; conditional E-value: 0.38
DUF3475 25 varLreeilrseGV 38
v+ L+++ l s G
NP_001331590.1 318 VKSLKKKSLWSRGF 331
78899998888885 PP
== domain 3 score: -2.6 bits; conditional E-value: 0.33
DUF3475 9 lmsKlvhLwqsL 20
+m Klv ++++L
NP_001331590.1 334 VMEKLVDIVHFL 345
899***999988 PP
Or compare NP_001331590.1 to CDD or PaperBLAST