NP_001342660.1 has 601 amino acids
Query: DUF4502 [M=376]
Accession: PF14950.10
Description: Domain of unknown function (DUF4502)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-29 89.4 0.1 2.7e-29 88.8 0.1 1.3 1 NP_001342660.1
Domain annotation for each sequence (and alignments):
>> NP_001342660.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.8 0.1 2.7e-29 2.7e-29 319 376 .] 1 58 [. 1 58 [. 0.99
Alignments for each domain:
== domain 1 score: 88.8 bits; conditional E-value: 2.7e-29
DUF4502 319 vqvAlCeqleeagakspsqavapeegaslkvLFtretAarLrgrPqDivhiyPPWqkL 376
+qvA+Ceql++++ +sp+ + ap++ga+lkvLFtretA++L+g+PqDi++i+PPWqkL
NP_001342660.1 1 MQVAVCEQLAGPPITSPPGGLAPRPGAYLKVLFTRETADHLMGHPQDIIYIFPPWQKL 58
9********************************************************8 PP
Or compare NP_001342660.1 to CDD or PaperBLAST