PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001345706.1 to PF04783 (DUF630)

NP_001345706.1 has 783 amino acids

Query:       DUF630  [M=59]
Accession:   PF04783.16
Description: Protein of unknown function (DUF630)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.2e-31   93.3   0.3    1.3e-30   91.6   0.3    2.0  1  NP_001345706.1  


Domain annotation for each sequence (and alignments):
>> NP_001345706.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.6   0.3   1.3e-30   1.3e-30       1      59 []       1      59 [.       1      59 [. 0.98

  Alignments for each domain:
  == domain 1  score: 91.6 bits;  conditional E-value: 1.3e-30
          DUF630  1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59
                    MGca+Skl+d +avalCreR+ +l++a+++RyaLAaaH+aY++SL+++g++L+ F++++
  NP_001345706.1  1 MGCASSKLEDLPAVALCRERCGFLDEAIHQRYALAAAHIAYINSLKSIGHSLHLFIQQD 59
                    ********************************************************985 PP



Or compare NP_001345706.1 to CDD or PaperBLAST