NP_001353131.1 has 118 amino acids
Query: DUF3695 [M=101]
Accession: PF12494.12
Description: Protein of unknown function (DUF3695)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.2e-26 76.0 0.1 1.3e-25 75.5 0.1 1.2 1 NP_001353131.1
Domain annotation for each sequence (and alignments):
>> NP_001353131.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.5 0.1 1.3e-25 1.3e-25 32 97 .. 9 72 .. 3 76 .. 0.89
Alignments for each domain:
== domain 1 score: 75.5 bits; conditional E-value: 1.3e-25
DUF3695 32 ayffdpkiPkDsLDfrLaarYdhhteafkekneillqqeTiqdtsgrvlknfptevlsppkedplt 97
+ ++ iPkD+LDfrLaa+Y+hht++fk+k+eill+q+T+qdt + ++ +fp+e+l+pp++ p+t
NP_001353131.1 9 RRLEEAPIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYR-TKIQFPGEFLTPPTP-PIT 72
4566889***********************************9987.*************99.776 PP
Or compare NP_001353131.1 to CDD or PaperBLAST