PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001376200.1 to PF20173 (ZnF_RZ-type)

NP_001376200.1 has 1907 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.3
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.3e-27   79.1   1.9    7.3e-27   79.1   1.9    4.0  5  NP_001376200.1  


Domain annotation for each sequence (and alignments):
>> NP_001376200.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -7.9   4.2         1         1      24      37 ..    1432    1444 ..    1432    1447 .. 0.69
   2 ?  -11.3   8.9         1         1      32      40 ..    1473    1481 ..    1470    1497 .. 0.62
   3 ?   -4.7   6.8         1         1      16      38 ..    1538    1558 ..    1536    1560 .. 0.83
   4 ?   -3.3   0.2      0.41      0.41      32      41 ..    1609    1618 ..    1605    1618 .. 0.81
   5 !   79.1   1.9   7.3e-27   7.3e-27       8      53 ..    1833    1878 ..    1824    1879 .. 0.93

  Alignments for each domain:
  == domain 1  score: -7.9 bits;  conditional E-value: 1
     ZnF_RZ-type   24 eCGrameesrCpeC 37  
                      +CG+a   ++C  C
  NP_001376200.1 1432 DCGHACP-GSCHSC 1444
                      7888874.567777 PP

  == domain 2  score: -11.3 bits;  conditional E-value: 1
     ZnF_RZ-type   32 srCpeCgat 40  
                      ++Cp C++t
  NP_001376200.1 1473 GECPPCQRT 1481
                      566666654 PP

  == domain 3  score: -4.7 bits;  conditional E-value: 1
     ZnF_RZ-type   16 nGHpYvigeCGrameesrCpeCg 38  
                      +GHp+ ig CG++    +C  C+
  NP_001376200.1 1538 CGHPC-IGLCGEPCP-RKCRVCH 1558
                      89998.8******86.5788886 PP

  == domain 4  score: -3.3 bits;  conditional E-value: 0.41
     ZnF_RZ-type   32 srCpeCgatI 41  
                      + Cp C+ +I
  NP_001376200.1 1609 KVCPICQVPI 1618
                      68****9987 PP

  == domain 5  score: 79.1 bits;  conditional E-value: 7.3e-27
     ZnF_RZ-type    8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53  
                      +ghw+kCpnGH+Yvi+eCG+am++s+CpeC++ IGGe+h+l+++n 
  NP_001376200.1 1833 RGHWFKCPNGHIYVITECGGAMQRSTCPECQEVIGGENHTLERSNH 1878
                      89***************************************99985 PP



Or compare NP_001376200.1 to CDD or PaperBLAST