NP_001391059.1 has 1594 amino acids
Query: DUF4683 [M=411] Accession: PF15735.9 Description: Domain of unknown function (DUF4683) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-16 45.4 0.3 9.1e-16 44.5 0.3 1.4 1 NP_001391059.1 Domain annotation for each sequence (and alignments): >> NP_001391059.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.5 0.3 9.1e-16 9.1e-16 352 410 .. 580 638 .. 563 639 .. 0.90 Alignments for each domain: == domain 1 score: 44.5 bits; conditional E-value: 9.1e-16 DUF4683 352 tlsfrkrssailsppqpsysaeaeDcdlnysdvmsklGflserslspvelspPrCwsps 410 +++ r+r ++ l pqpsy+a a+D++ +ysdv+ kl fl +s + + spPrCw ps NP_001391059.1 580 EVKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPS 638 4556999999***********************************************98 PP
Or compare NP_001391059.1 to CDD or PaperBLAST