NP_010369.3 has 199 amino acids
Query: DUF846 [M=139] Accession: PF05832.16 Description: Eukaryotic protein of unknown function (DUF846) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-52 163.6 9.4 1.8e-52 163.3 9.4 1.1 1 NP_010369.3 Domain annotation for each sequence (and alignments): >> NP_010369.3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 163.3 9.4 1.8e-52 1.8e-52 1 139 [] 15 156 .. 15 156 .. 0.96 Alignments for each domain: == domain 1 score: 163.3 bits; conditional E-value: 1.8e-52 DUF846 1 shpvallfhllfkllailvyllgslfsssfilsfvivilllaldfwlvknitGrlLVglrWwnevde.dgeskwvFesr...eekrkvnaidsklFWl 94 shp++l+fhl+ k+++i++y++gs+f +f+ +f++v+lll++df+l+knitGr+LV+lrWw++ ++ +++s+++Fes+ + ++naidsklFW+ NP_010369.3 15 SHPLLLSFHLAGKAVPIVFYIIGSMFL-NFTPQFITVVLLLSFDFYLTKNITGRKLVQLRWWYDSTDvNKDSNFTFESYkqyAPGPPINAIDSKLFWW 111 7***********************996.9***********************************999788999******777778888********** PP DUF846 95 alyvtpllwilllilallslkflwlllviialvlsltnllgfvkc 139 ++yvtp++w ++++l+ll+lk+++l+lvi+a++l+++n++gf c NP_010369.3 112 SMYVTPVIWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCC 156 ******************************************999 PP
Or compare NP_010369.3 to CDD or PaperBLAST