NP_011665.1 has 432 amino acids
Query: DUF2838 [M=111] Accession: PF10998.12 Description: Protein of unknown function (DUF2838) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-46 143.7 18.1 1.3e-46 143.7 18.1 2.7 3 NP_011665.1 Domain annotation for each sequence (and alignments): >> NP_011665.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 143.7 18.1 1.3e-46 1.3e-46 1 111 [] 112 222 .. 112 222 .. 0.99 2 ? -1.7 0.1 0.18 0.18 78 98 .. 265 285 .. 257 298 .. 0.51 3 ? -1.4 2.5 0.15 0.15 25 53 .. 340 368 .. 300 373 .. 0.60 Alignments for each domain: == domain 1 score: 143.7 bits; conditional E-value: 1.3e-46 DUF2838 1 dklsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplalAiitwr 98 +k ++ ++++n++++++l+g++pe+++++yt+l++vl+p+r++ty+k+k hYfl+D+CYfvn+l+ll+++++p s +lf+++f++++G+l +A+itwr NP_011665.1 112 EKAFYPFTLFNIFFIGFLMGRFPEWFHVYYTILFFVLMPIRFYTYYKTKNHYFLADFCYFVNMLCLLFIWIFPYSYSLFQSCFAFTFGTLCFAVITWR 209 7999********************************************************************************************** PP DUF2838 99 nslvfhsldkvtS 111 nslv+hs+dk+tS NP_011665.1 210 NSLVIHSIDKTTS 222 ************8 PP == domain 2 score: -1.7 bits; conditional E-value: 0.18 DUF2838 78 lfkavfvlanGplalAiitwr 98 l ++++ l +l it++ NP_011665.1 265 LWTSLYYLVWQSLYHYFITLK 285 444444444444444444444 PP == domain 3 score: -1.4 bits; conditional E-value: 0.15 DUF2838 25 llplvytvlllvllplryvtyrkkklhYf 53 +++ y ++++++l++ ++ +++ Y+ NP_011665.1 340 GIWIRYKLAAALFLTIVFLWASHNGATYY 368 34555555555555555555555555555 PP
Or compare NP_011665.1 to CDD or PaperBLAST