NP_011703.3 has 394 amino acids
Query: DUF384 [M=55]
Accession: PF04064.17
Description: Domain of unknown function (DUF384)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-30 89.8 0.1 1.5e-29 88.0 0.1 2.0 2 NP_011703.3
Domain annotation for each sequence (and alignments):
>> NP_011703.3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.5 0.0 0.58 0.58 40 53 .. 47 60 .. 46 61 .. 0.80
2 ! 88.0 0.1 1.5e-29 1.5e-29 1 54 [. 306 359 .. 306 360 .. 0.97
Alignments for each domain:
== domain 1 score: -3.5 bits; conditional E-value: 0.58
DUF384 40 cerlVqlLirdEee 53
+++++++++ E +
NP_011703.3 47 IKDIIKMIMDPEHG 60
568999**998875 PP
== domain 2 score: 88.0 bits; conditional E-value: 1.5e-29
DUF384 1 sLllLcttregReylRskgvYpilRelHkaeedekvreacerlVqlLirdEeee 54
s+llLctt +gReylR+k+vYp++RelHk++e+e++ e c r+V++L+r+E++
NP_011703.3 306 SILLLCTTHAGREYLRDKSVYPLVRELHKNVENEDIGELCYRIVNMLMRGEPGA 359
89*************************************************986 PP
Or compare NP_011703.3 to CDD or PaperBLAST