NP_055501.2 has 1070 amino acids
Query: DUF4745 [M=133] Accession: PF15923.9 Description: Domain of unknown function (DUF4745) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-58 182.4 1.3 4.1e-58 181.3 1.3 1.6 1 NP_055501.2 Domain annotation for each sequence (and alignments): >> NP_055501.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.3 1.3 4.1e-58 4.1e-58 2 133 .] 60 187 .. 59 187 .. 0.99 Alignments for each domain: == domain 1 score: 181.3 bits; conditional E-value: 4.1e-58 DUF4745 2 ssgsnsaipaktaisdclsawvkYLqalnnlCaAgsrLadslaallrnsipsklamqlktvwedlvrAstvatstiKseilslLqefstmaassvdqe 99 ++++++a+p+ t+i+d++++++kYL+aln++C+A+++L+d++++++rns++sk+a qlk+v+e++++A++++ts+iK+ei+++L+e+s++aa+++dq+ NP_055501.2 60 AGSCHHAMPHTTPIADIQQGISKYLDALNVFCRASTFLTDLFSTVFRNSHYSKAATQLKDVQEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQK 157 79************************************************************************************************ PP DUF4745 100 sfslldiqrireillenlltvinlqfqflaasld 133 +fsl+di+ +l++++ltv++++fqfl+ +l+ NP_055501.2 158 EFSLQDIE----VLGRCFLTVVQVHFQFLTHALQ 187 ********....******************9986 PP
Or compare NP_055501.2 to CDD or PaperBLAST