PaperBLAST – Find papers about a protein or its homologs

 

Align NP_065435.1 to PF04418 (DUF543)

NP_065435.1 has 97 amino acids

Query:       DUF543  [M=75]
Accession:   PF04418.17
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-36  109.9   0.2    2.9e-36  109.6   0.2    1.2  1  NP_065435.1  


Domain annotation for each sequence (and alignments):
>> NP_065435.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.6   0.2   2.9e-36   2.9e-36       6      75 .]      19      87 ..       4      87 .. 0.86

  Alignments for each domain:
  == domain 1  score: 109.6 bits;  conditional E-value: 2.9e-36
       DUF543  6 kkkkskpssesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasFr 75
                 ++k+ + + +++l+ kwD +Lsn+lvkt++G+gvGv++svl+f+rRa+pvwlG+GfG+Gr+Yae+da+Fr
  NP_065435.1 19 SNKNGSSV-STILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
                 23333333.69**********************************************************6 PP



Or compare NP_065435.1 to CDD or PaperBLAST