NP_075736.1 has 185 amino acids
Query: DUF498 [M=109] Accession: PF04430.19 Description: Protein of unknown function (DUF498/DUF598) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-40 122.8 0.0 7.4e-40 121.6 0.0 1.5 2 NP_075736.1 Domain annotation for each sequence (and alignments): >> NP_075736.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.0 0.19 0.19 28 46 .. 24 43 .. 18 51 .. 0.68 2 ! 121.6 0.0 7.4e-40 7.4e-40 1 109 [] 61 169 .. 61 169 .. 0.98 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.19 EE-HHCS.TTCEECHHHHHH CS DUF498 28 fawesak.aedlteeslall 46 + w++ + +++l++++ +l+ NP_075736.1 24 RLWRNPRrGHRLSPADDELY 43 67877444999999987777 PP == domain 2 score: 121.6 bits; conditional E-value: 7.4e-40 EEEEESSEEEETTEEESSEEEE-SSSEEE-HHCSTTCEECHHHHHHCT..T..SEEEEE-TTS-----HHHHHHHHCCTSEEEEE-HHHHHHHHHHHH CS DUF498 1 idgygeggfrvngvkyegsllvlpgevfawesakaedlteeslallellepkpellilGtGarlrklppelrealkergigvevmdtraAcrtyNvla 98 id+y+++gf++ g+++ g++++lp+ v +w++ +++d+tees++l+ +lep++e++++GtG+++++l+p++++a+++rgi+vev+dt++Ac+t+N+l NP_075736.1 61 IDSYSSRGFTICGNRVFGPCVLLPQTVVQWNVGSHQDITEESFSLFWMLEPRIEIVVVGTGNKTERLHPQVLQAMRQRGIAVEVQDTPNACATFNFLC 158 89****************************9767**************************************************************** PP HHT--EEEEEE CS DUF498 99 segrrvaaali 109 +egr +aali NP_075736.1 159 HEGRVTGAALI 169 *********98 PP
Or compare NP_075736.1 to CDD or PaperBLAST