NP_080543.2 has 275 amino acids
Query: DUF1681 [M=158] Accession: PF07933.18 Description: Protein of unknown function (DUF1681) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-65 205.3 0.0 2.9e-65 205.0 0.0 1.1 1 NP_080543.2 Domain annotation for each sequence (and alignments): >> NP_080543.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 205.0 0.0 2.9e-65 2.9e-65 1 158 [] 7 164 .. 7 164 .. 0.95 Alignments for each domain: == domain 1 score: 205.0 bits; conditional E-value: 2.9e-65 DUF1681 1 iervllvakevhvYkippltsskgyraadWtakepiwtgrlrvvekgkkvdikLedkktgelfaaapve.tkeaavekvlDSsRyFvlrvedekgrka 97 +e+vl+v+++v+vY+ipp++s++gyra+dW+ ++p wtgrlr+++kgk + ikLedk +gelfa+apve ave+v+DSsRyFv+r++d +gr+a NP_080543.2 7 YESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEqYPGIAVETVTDSSRYFVIRIQDGTGRSA 104 799*****************************************************************9755689*********************** PP DUF1681 98 flGigFeeRsdafdfnvalqdaekrlkkekeaeekekeeeekkekkdysLkeGetikinlg 158 f+GigF++R dafdfnv+lqd++k++k+e+e ++ e++e +++ k d+ +keG+tik+++g NP_080543.2 105 FIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISK-ESQEMDNRPKLDLGFKEGQTIKLSIG 164 ********************************97.566666666**************986 PP
Or compare NP_080543.2 to CDD or PaperBLAST