NP_084160.2 has 624 amino acids
Query: DUF5009 [M=260]
Accession: PF16401.9
Description: Domain of unknown function (DUF5009)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-10 27.6 0.8 1.1e-10 27.6 0.8 2.5 3 NP_084160.2
Domain annotation for each sequence (and alignments):
>> NP_084160.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 0.0 0.0 0.027 0.027 3 18 .. 230 245 .. 228 249 .. 0.86
2 ! 27.6 0.8 1.1e-10 1.1e-10 48 104 .. 262 318 .. 254 358 .. 0.88
3 ? -4.1 0.1 0.47 0.47 110 157 .. 587 608 .. 580 621 .. 0.39
Alignments for each domain:
== domain 1 score: 0.0 bits; conditional E-value: 0.027
DUF5009 3 ksldalrGiaillmvl 18
+++d++rG+a++lmv+
NP_084160.2 230 RCVDTFRGLALVLMVF 245
679***********97 PP
== domain 2 score: 27.6 bits; conditional E-value: 1.1e-10
DUF5009 48 pGitwvdlvfpfflfamGaaiplalkkkvekgssklkvlldiikrfvlltffalftm 104
G+t dlvfp+f+f mG++i l+++ ++g sklk+l +i+ r ll+ + +
NP_084160.2 262 NGLTVADLVFPWFVFIMGTSIFLSMTSILQRGCSKLKLLGKIVWRSFLLICIGVIIV 318
699******************************************999998887765 PP
== domain 3 score: -4.1 bits; conditional E-value: 0.47
DUF5009 110 vlssepelkeqllsivcfvllfllylsikkklkkkaalvikvvaflla 157
l+ e+ ke+l++ ++va +l
NP_084160.2 587 KLADEQSHKEHLIQ--------------------------NIVATALW 608
44444444444433..........................22222221 PP
Or compare NP_084160.2 to CDD or PaperBLAST