PaperBLAST – Find papers about a protein or its homologs

 

Align NP_252920.1 to PF01817 (CM_2)

NP_252920.1 has 101 amino acids

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-22   65.6   0.1    2.5e-22   65.4   0.1    1.0  1  NP_252920.1  


Domain annotation for each sequence (and alignments):
>> NP_252920.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.4   0.1   2.5e-22   2.5e-22       1      78 [.      14      90 ..      14      91 .. 0.96

  Alignments for each domain:
  == domain 1  score: 65.4 bits;  conditional E-value: 2.5e-22
         CM_2  1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
                 R+ Id+iD ++++ l +Rm+++k++ ++K+ ++ ++  peR++++l +++++aee+gld+ +ve +f +ii++ +a Q
  NP_252920.1 14 REAIDRIDLDIVQALGRRMDYVKAASRFKA-SEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQ 90
                 99***************************6.6669****************************************998 PP



Or compare NP_252920.1 to CDD or PaperBLAST