NP_311717.1 has 72 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-28 85.2 2.3 1.4e-28 85.0 2.3 1.1 1 NP_311717.1
Domain annotation for each sequence (and alignments):
>> NP_311717.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.0 2.3 1.4e-28 1.4e-28 1 49 [] 23 71 .. 23 71 .. 0.98
Alignments for each domain:
== domain 1 score: 85.0 bits; conditional E-value: 1.4e-28
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
+yv++TkDG++i+t+gkPe+D+dtG+++Y+d++G+ +qIn+ddV+qI+e
NP_311717.1 23 DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIE 71
6**********************************************98 PP
Or compare NP_311717.1 to CDD or PaperBLAST