NP_391190.1 has 241 amino acids
Query: LiaF-like_C [M=114]
Accession: PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.5e-40 122.1 0.7 7.7e-40 121.6 0.7 1.2 1 NP_391190.1
Domain annotation for each sequence (and alignments):
>> NP_391190.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 121.6 0.7 7.7e-40 7.7e-40 1 114 [] 126 238 .. 126 238 .. 0.99
Alignments for each domain:
== domain 1 score: 121.6 bits; conditional E-value: 7.7e-40
LiaF-like_C 1 liGdqklgkepyelediniqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvldekeagllnesvkleseeyeeae 98
+iG+ +++k+p++l+d+n++ +iGd++iDLska++p+ge++ivi+++iG+v+i+VP+d+ev v+++v++G+++++++k++g l+ +v+ s+++ e++
NP_391190.1 126 FIGELQMMKQPFDLNDLNVSGFIGDIKIDLSKAMIPEGESTIVISGVIGNVDIYVPSDLEVAVSSAVFIGDINLIGSKKSG-LSTKVYAASTDFSESK 222
79*******************************************************************************.8888************ PP
LiaF-like_C 99 rkvkiivslliGdveV 114
r+vk++vsl+iGdv+V
NP_391190.1 223 RRVKVSVSLFIGDVDV 238
**************98 PP
Or compare NP_391190.1 to CDD or PaperBLAST