PaperBLAST – Find papers about a protein or its homologs

 

Align NP_415835.1 to PF04338 (DUF481)

NP_415835.1 has 301 amino acids

Query:       DUF481  [M=210]
Accession:   PF04338.16
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.5e-12   32.8   1.1    3.5e-12   32.8   1.1    2.0  2  NP_415835.1  


Domain annotation for each sequence (and alignments):
>> NP_415835.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.8   1.1   3.5e-12   3.5e-12      93     196 ..      95     205 ..      94     212 .. 0.85
   2 ?   -1.1   0.1     0.087     0.087     103     135 ..     268     299 ..     255     301 .] 0.57

  Alignments for each domain:
  == domain 1  score: 32.8 bits;  conditional E-value: 3.5e-12
       DUF481  93 GyqlidtdktklsleaGpgyryekftdgpedeeeviarasl..dyeykisdnlkftqelealv.....nleggsnttlrsetgltakltdalalkisy 183
                   yq++++d++++ l +G     +++ d+p +++  + r+++  d++ k++d+l+f+ +l++++     n +g ++t++++etgl++ +++ +al+++y
  NP_415835.1  95 HYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIapDWDVKLTDDLRFNGWLSMYKfandlNTTGYADTRVETETGLQYTFNETVALRVNY 192
                  59*****************99999****99999999999883345779*************8633333667889999********************* PP

       DUF481 184 evdydskppegkk 196
                   ++   +++++++
  NP_415835.1 193 YLERGFNMDDSRN 205
                  9988777777655 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.087
       DUF481 103 klsleaGpgyryekftdgpedeeeviarasldy 135
                   ls+ + +++++++ ++g +++++  a ++++y
  NP_415835.1 268 GLSVSLEYAFEWQDHDEG-DSDKFHYAGVGVNY 299
                  355555555555555555.55555555555555 PP



Or compare NP_415835.1 to CDD or PaperBLAST