NP_416511.4 has 109 amino acids
Query: DUF496 [M=93]
Accession: PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.1e-50 153.1 7.2 1e-49 152.9 7.2 1.0 1 NP_416511.4
Domain annotation for each sequence (and alignments):
>> NP_416511.4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 152.9 7.2 1e-49 1e-49 1 93 [] 8 100 .. 8 100 .. 0.98
Alignments for each domain:
== domain 1 score: 152.9 bits; conditional E-value: 1e-49
DUF496 1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklkel 93
+++vle+vr +rrknkl+rei+d+ekkirdn+krv ll+nl++yikp ms e i+ ii+ mk+dyedrvddyiik+aelskerr++skklk++
NP_416511.4 8 FQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKAM 100
699***************************************************************************************976 PP
Or compare NP_416511.4 to CDD or PaperBLAST