NP_416511.4 has 109 amino acids
Query: DUF496 [M=93]
Accession: PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-50 154.8 7.3 2.9e-50 154.6 7.3 1.0 1 NP_416511.4
Domain annotation for each sequence (and alignments):
>> NP_416511.4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 154.6 7.3 2.9e-50 2.9e-50 1 93 [] 8 100 .. 8 100 .. 0.98
Alignments for each domain:
== domain 1 score: 154.6 bits; conditional E-value: 2.9e-50
DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklkel 93
+++vle+vr +rrknkl+rei+d ekkirdnqkrv+ll+nl++yikp ms+e i+ ii++mk+dyedrvddyiiknaelskerr++skklk++
NP_416511.4 8 FQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKAM 100
689***************************************************************************************975 PP
Or compare NP_416511.4 to CDD or PaperBLAST