NP_564368.1 has 442 amino acids
Query: DUF295 [M=259] Accession: PF03478.22 Description: Domain of unknown function (DUF295) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-14 37.9 0.0 1.6e-13 37.0 0.0 1.4 1 NP_564368.1 Domain annotation for each sequence (and alignments): >> NP_564368.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.0 0.0 1.6e-13 1.6e-13 12 215 .. 124 343 .. 112 346 .. 0.63 Alignments for each domain: == domain 1 score: 37.0 bits; conditional E-value: 1.6e-13 DUF295 12 edsst..lfslpdgklyr...rlklPeg.rrrcvgssggwLltader..ssnlfllnpltgarieLPplst...lp.ve.............ellirk 84 +++++ lf+ + + yr +P+g gssgg + + e+ + + l+npl g+ +LPp+s+ +p + NP_564368.1 124 SNKAEgfLFDPNEIRWYRlsfA-YIPSGfY--PSGSSGGLVSWVSEEagLKTILLCNPLVGSVSQLPPISRprlFPsIGlsvtptsidvtvaG----- 213 3333345888766677877533.8999954..689***9999666555745799***************865554433365554433222220..... PP DUF295 85 vvlsaspssdyvvvlisgesggklafcrsg..dssWttieee....gegyedvvfhkgkfYaltntg.evvvldlgsdeplevs....evvkskerky 171 +d++ + ++ +++ + + g s W + ++ + + +v+ +gkfY+++++ +v ++++++ +++ ++ + NP_564368.1 214 --------DDLISPYAVKNLSSESFHVDAGgfFSLWAMTSSLprlcSLESGKMVYVQGKFYCMNYSPfSVLSYEVTGNRWIKIQapmrRF---LRSPS 300 ........22222222222233333333332222343333224443223458***********997656666776555565555433222...23558 PP DUF295 172 lVessGelllVrrylkkeskrtvefeVykldleeeakweevesL 215 l es G+l+lV + k++ + ++ +++ l+ + +a w+e+e + NP_564368.1 301 LLESKGRLILVAAVEKSKLNVPKSLRLWSLQQD-NATWVEIERM 343 ************88777888899*******998.779***9976 PP
Or compare NP_564368.1 to CDD or PaperBLAST