PaperBLAST – Find papers about a protein or its homologs

 

Align NP_568972.2 to PF02594 (DUF167)

NP_568972.2 has 232 amino acids

Query:       DUF167  [M=76]
Accession:   PF02594.20
Description: Uncharacterised ACR, YggU family COG1872
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-22   65.0   0.1    4.4e-22   64.4   0.1    1.3  1  NP_568972.2  


Domain annotation for each sequence (and alignments):
>> NP_568972.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.4   0.1   4.4e-22   4.4e-22       2      76 .]     144     215 ..     143     215 .. 0.96

  Alignments for each domain:
  == domain 1  score: 64.4 bits;  conditional E-value: 4.4e-22
       DUF167   2 vllavrvkPgakkdaigeeeaegrealkvrvaappvdGkANaaliefLakalgvpksdveivsGetsreKvvrie 76 
                  v++a++v+ +a+++ai+   +++++ ++v vaap+ +G+AN++l+ef+ ++lg++ s++++++G+ s++K++++e
  NP_568972.2 144 VQVAIEVEDRAQRSAIT---RVNADDVRVTVAAPAARGEANNELLEFMGRVLGLRLSQMTLQRGWNSKSKLLVVE 215
                  789**************...788899*********************************************9986 PP



Or compare NP_568972.2 to CDD or PaperBLAST