NP_569049.1 has 108 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-20 59.1 11.7 7e-20 57.6 11.7 2.0 1 NP_569049.1
Domain annotation for each sequence (and alignments):
>> NP_569049.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.6 11.7 7e-20 7e-20 20 50 .] 78 108 .] 35 108 .] 0.90
Alignments for each domain:
== domain 1 score: 57.6 bits; conditional E-value: 7e-20
DUF1674 20 vnpktgEigGpkgpEPtRygDWerkGrvsDF 50
vn++tgEigGp+gpEPtRygDWe +Gr+sDF
NP_569049.1 78 VNEDTGEIGGPRGPEPTRYGDWEQRGRCSDF 108
9****************************** PP
Or compare NP_569049.1 to CDD or PaperBLAST