PaperBLAST – Find papers about a protein or its homologs

 

Align NP_572954.2 to PF10166 (DUF2368)

NP_572954.2 has 154 amino acids

Query:       DUF2368  [M=134]
Accession:   PF10166.13
Description: Uncharacterised conserved protein (DUF2368)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.6e-48  148.2   0.0      7e-48  147.9   0.0    1.1  1  NP_572954.2  


Domain annotation for each sequence (and alignments):
>> NP_572954.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.9   0.0     7e-48     7e-48      19     134 .]      22     137 ..       4     137 .. 0.96

  Alignments for each domain:
  == domain 1  score: 147.9 bits;  conditional E-value: 7e-48
      DUF2368  19 fleelqklqlerqlamqnlmrerqmAlqiaksrellkwlasfyalavvllaagaikrkkpllliPlvPLtfvvgYqydlaYGdklerireeAerilee 116
                    +++q+l++er+++m+ ++++r++Al ia++rel++wl+ fy+ av+++a  +++ ++ ++l+Pl+PLtfvvgY++d+aYG+k++ri++eA++i+e+
  NP_572954.2  22 SYRKCQELKMERWIQMHYQIKQREQALAIAHHRELFYWLSGFYLSAVYGCASYYQRVRRVSALAPLLPLTFVVGYYTDWAYGSKMHRIQAEANMIMEH 119
                  6789********************************************************************************************** PP

      DUF2368 117 esellelPkglptvesie 134
                  e+ell++P+glptv+ i+
  NP_572954.2 120 EQELLHWPGGLPTVAGID 137
                  **************9997 PP



Or compare NP_572954.2 to CDD or PaperBLAST