PaperBLAST – Find papers about a protein or its homologs

 

Align NP_611882.1 to PF04418 (DUF543)

NP_611882.1 has 81 amino acids

Query:       DUF543  [M=75]
Accession:   PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-28   84.5   0.0    2.2e-28   84.3   0.0    1.0  1  NP_611882.1  


Domain annotation for each sequence (and alignments):
>> NP_611882.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.3   0.0   2.2e-28   2.2e-28       2      75 .]       6      79 ..       5      79 .. 0.95

  Alignments for each domain:
  == domain 1  score: 84.3 bits;  conditional E-value: 2.2e-28
       DUF543  2 etqekkkkskpssesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasFr 75
                 ++++k+++++p+  s+ ++++D+cL+++++k g+Gl++G +++++++r++++p+wlGlG+G+G aY++c+a+++
  NP_611882.1  6 QKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLFFTRPQTYPIWLGLGVGMGVAYDCCQARWN 79
                 67788899999999*********************************************************996 PP



Or compare NP_611882.1 to CDD or PaperBLAST