NP_612420.1 has 231 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-18 52.8 0.6 2.7e-18 52.2 0.6 1.3 1 NP_612420.1
Domain annotation for each sequence (and alignments):
>> NP_612420.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.2 0.6 2.7e-18 2.7e-18 6 61 .. 164 219 .. 159 225 .. 0.93
Alignments for each domain:
== domain 1 score: 52.2 bits; conditional E-value: 2.7e-18
GARIL_Rab2_bd 6 rllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLr 61
l+Plkfv+l v+dk+ ++l +kl t R+fyl+L ++ ++++ f +w+rl++ Lr
NP_612420.1 164 GLFPLKFVQLFVHDKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFGQWVRLLYRLR 219
589*************************************************9887 PP
Or compare NP_612420.1 to CDD or PaperBLAST