NP_649378.1 has 969 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.3e-17 47.8 2.9 3e-16 45.9 2.9 2.2 1 NP_649378.1
Domain annotation for each sequence (and alignments):
>> NP_649378.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.9 2.9 3e-16 3e-16 2 62 .. 809 869 .. 808 871 .. 0.96
Alignments for each domain:
== domain 1 score: 45.9 bits; conditional E-value: 3e-16
DUF1771 2 erlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfee 62
e+ R++A +h ++++e++ kA++A +rG+ + A ++se +k h++k + +n++Aa+ I+e
NP_649378.1 809 EETRNMAAHHSQLKAECYLKAKQAVQRGNSSVALYYSEIAKLHKQKIDVFNQRAANCIMEV 869
678*******************************************************986 PP
Or compare NP_649378.1 to CDD or PaperBLAST