NP_652484.1 has 74 amino acids
Query: DUF543 [M=75]
Accession: PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-26 77.9 0.2 2.4e-26 77.8 0.2 1.0 1 NP_652484.1
Domain annotation for each sequence (and alignments):
>> NP_652484.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.8 0.2 2.4e-26 2.4e-26 14 74 .. 5 65 .. 1 66 [. 0.93
Alignments for each domain:
== domain 1 score: 77.8 bits; conditional E-value: 2.4e-26
DUF543 14 sesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasF 74
e+ l e +cLs+ lvk Gl++G v+++l+frrR++pvwlG+GfG+G aY c++++
NP_652484.1 5 PEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGTGFGVGVAYRGCEKEL 65
468999***************************************************9876 PP
Or compare NP_652484.1 to CDD or PaperBLAST