PaperBLAST – Find papers about a protein or its homologs

 

Align NP_652484.1 to PF04418 (DUF543)

NP_652484.1 has 74 amino acids

Query:       DUF543  [M=75]
Accession:   PF04418.17
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-26   77.9   0.2    2.4e-26   77.8   0.2    1.0  1  NP_652484.1  


Domain annotation for each sequence (and alignments):
>> NP_652484.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.8   0.2   2.4e-26   2.4e-26      14      74 ..       5      65 ..       1      66 [. 0.93

  Alignments for each domain:
  == domain 1  score: 77.8 bits;  conditional E-value: 2.4e-26
       DUF543 14 sesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasF 74
                  e+ l e   +cLs+ lvk   Gl++G v+++l+frrR++pvwlG+GfG+G aY  c++++
  NP_652484.1  5 PEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGTGFGVGVAYRGCEKEL 65
                 468999***************************************************9876 PP



Or compare NP_652484.1 to CDD or PaperBLAST