NP_705693.2 has 1067 amino acids
Query: UBAP2-Lig [M=33]
Accession: PF12478.12
Description: UBAP2/protein lingerer
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-20 58.8 0.2 5.3e-20 57.6 0.2 1.7 1 NP_705693.2
Domain annotation for each sequence (and alignments):
>> NP_705693.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.6 0.2 5.3e-20 5.3e-20 2 33 .] 495 526 .. 495 526 .. 0.97
Alignments for each domain:
== domain 1 score: 57.6 bits; conditional E-value: 5.3e-20
UBAP2-Lig 2 pSkIPasAVEMPgdanissLDVQFGaldFGse 33
+SkIPa AVEMPg+a+is+L++QFGal+FGse
NP_705693.2 495 TSKIPALAVEMPGSADISGLNLQFGALQFGSE 526
5******************************8 PP
Or compare NP_705693.2 to CDD or PaperBLAST