NP_956849.2 has 210 amino acids
Query: PDC10_C [M=90]
Accession: PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-44 135.1 2.2 7.5e-44 134.1 2.2 1.6 1 NP_956849.2
Domain annotation for each sequence (and alignments):
>> NP_956849.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 134.1 2.2 7.5e-44 7.5e-44 1 90 [] 72 159 .. 72 159 .. 0.98
Alignments for each domain:
== domain 1 score: 134.1 bits; conditional E-value: 7.5e-44
PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90
+n++eslLr+a++ dveey+i+r e+efq+ln++araLk+iLs+iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
NP_956849.2 72 INFTESLLRMAAD-DVEEYMIDRPEREFQDLNERARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 159
89***********.********************************************************************.8899997 PP
Or compare NP_956849.2 to CDD or PaperBLAST