O15063 has 1070 amino acids
Query: DUF4745 [M=133] Accession: PF15923.9 Description: Domain of unknown function (DUF4745) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-58 182.4 1.3 4.1e-58 181.3 1.3 1.6 1 O15063 Domain annotation for each sequence (and alignments): >> O15063 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.3 1.3 4.1e-58 4.1e-58 2 133 .] 60 187 .. 59 187 .. 0.99 Alignments for each domain: == domain 1 score: 181.3 bits; conditional E-value: 4.1e-58 DUF4745 2 ssgsnsaipaktaisdclsawvkYLqalnnlCaAgsrLadslaallrnsipsklamqlktvwedlvrAstvatstiKseilslLqefstmaassvdqesfsl 103 ++++++a+p+ t+i+d++++++kYL+aln++C+A+++L+d++++++rns++sk+a qlk+v+e++++A++++ts+iK+ei+++L+e+s++aa+++dq++fsl O15063 60 AGSCHHAMPHTTPIADIQQGISKYLDALNVFCRASTFLTDLFSTVFRNSHYSKAATQLKDVQEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQKEFSL 161 79**************************************************************************************************** PP DUF4745 104 ldiqrireillenlltvinlqfqflaasld 133 +di+ +l++++ltv++++fqfl+ +l+ O15063 162 QDIE----VLGRCFLTVVQVHFQFLTHALQ 187 ****....******************9986 PP
Or compare O15063 to CDD or PaperBLAST