O30012 has 620 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-16 47.2 2.5 1.2e-16 47.2 2.5 2.8 3 O30012 Domain annotation for each sequence (and alignments): >> O30012 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.1 0.68 0.68 40 58 .. 124 143 .. 119 154 .. 0.70 2 ? -0.2 0.4 0.072 0.072 42 77 .. 213 247 .. 206 249 .. 0.70 3 ! 47.2 2.5 1.2e-16 1.2e-16 1 79 [] 270 345 .. 270 345 .. 0.95 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.68 CM_2 40 eReeevlerlre.gaeelgl 58 e e+ +le+lr+ ga +l O30012 124 EEEKVILEELRKcGAVLSRL 143 56778888888876644444 PP == domain 2 score: -0.2 bits; conditional E-value: 0.072 CM_2 42 eeevlerlregaeelgldpeavekifreiisesral 77 ee l+r++e e+ d+e ++if+ + + ++ O30012 213 REEYLRRAMELH-EKMKDRESFREIFESLRKIYTDY 247 567777777754.56678888999998887766655 PP == domain 3 score: 47.2 bits; conditional E-value: 1.2e-16 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 R I +iD+ +l+L+++R + a++ia++K e+g p+ ++ eee+l +++++ l+p +++if+ i+s ++ ++ O30012 270 RGLIKSIDSLILRLIERRIDAARQIARIKMERGEPIELKDVEEEKLWEVMSKT---TLNPVKLKEIFEGIMSLAKEEEY 345 66799**********************************************65...7****************999885 PP
Or compare O30012 to CDD or PaperBLAST