O48448 has 134 amino acids
Query: DUF3168 [M=117]
Accession: PF11367.12
Description: Protein of unknown function (DUF3168)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-19 55.4 0.0 4.3e-19 55.1 0.0 1.1 1 O48448
Domain annotation for each sequence (and alignments):
>> O48448
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.1 0.0 4.3e-19 4.3e-19 12 116 .. 24 126 .. 13 127 .. 0.93
Alignments for each domain:
== domain 1 score: 55.1 bits; conditional E-value: 4.3e-19
DUF3168 12 vaalvggrvydrapqgaalPyivlgevqvrpanalcgdgaevrlqldvwsraegrkeakalaaavraaLedaalaldggrlvslrlesarllrdpdgrlfrg 113
++++v+ v + + +++++Py+v+g +++p ++ ++ g++++++ +vw ++r+ea+++ v +aL ++l +g+++v+ l a++++d+dg + +g
O48448 24 LMEMVNQ-VTESPGKDDPYPYVVIGDQSSTPFETKSSFGENITMDFHVWG-GTTRAEAQDISSRVLEALTYKPLMFEGFTFVAKKLVLAQVITDTDGVTKHG 123
6666766.888999************************************.**************************************************9 PP
DUF3168 114 vld 116
++
O48448 124 IIK 126
975 PP
Or compare O48448 to CDD or PaperBLAST