PaperBLAST – Find papers about a protein or its homologs

 

Align P01849 to PF09291 (DUF1968)

P01849 has 136 amino acids

Query:       DUF1968  [M=81]
Accession:   PF09291.14
Description: Domain of unknown function (DUF1968)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.6e-44  135.5   1.8    4.9e-44  134.6   1.8    1.4  1  P01849    


Domain annotation for each sequence (and alignments):
>> P01849  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  134.6   1.8   4.9e-44   4.9e-44       1      81 []       6      86 ..       6      86 .. 0.99

  Alignments for each domain:
  == domain 1  score: 134.6 bits;  conditional E-value: 4.9e-44
  DUF1968  1 PavYqLkspkssdtsvCLfTDFdsqvnvsqskeseviktdktvldmksldsKSngavaWsnksdfkCqdtfkeetaflsss 81
             PavYqLk+p+s+d+++CLfTDFdsq+nv +++es +++tdktvldmk++dsKSnga+aWsn+++f+Cqd+fke++a+++ss
   P01849  6 PAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSS 86
             9*****************************************************************************997 PP



Or compare P01849 to CDD or PaperBLAST