P0A8W5 has 187 amino acids
Query: DUF179 [M=157] Accession: PF02622.19 Description: Uncharacterized ACR, COG1678 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-57 178.3 0.0 6.5e-57 178.1 0.0 1.0 1 P0A8W5 Domain annotation for each sequence (and alignments): >> P0A8W5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.1 0.0 6.5e-57 6.5e-57 1 157 [] 12 174 .. 12 174 .. 0.95 Alignments for each domain: == domain 1 score: 178.1 bits; conditional E-value: 6.5e-57 DUF179 1 PsledpnFersVvllcehneegamGlvlNrpl.eltlkelleelleleaepaaee.....pvylGGPveqdrlfvlhsle..lessleisdglyltgsldile 95 P+l+dp F+rsVv++cehn +gamG+++N+pl +l+++ +le+ l+++ ep++e+ pv+lGGP+++dr+f+lh+ + + ss++isd++++t+s+d+le P0A8W5 12 PALQDPIFRRSVVYICEHNTNGAMGIIVNKPLeNLKIEGILEK-LKITPEPRDESirldkPVMLGGPLAEDRGFILHTPPsnFASSIRISDNTVMTTSRDVLE 113 89******************************99*********.7888777776358*********************55669******************** PP DUF179 96 alaggagpeklrvflGyagWgagQLeeEieenaWlvvpasdeellfetppeelWeealrrlG 157 +l ++++p++++v+lGya+W++gQLe+Ei +naWl++pa d ++lf+tp +++W+ea++ +G P0A8W5 114 TLGTDKQPSDVLVALGYASWEKGQLEQEILDNAWLTAPA-DLNILFKTPIADRWREAAKLIG 174 ***************************************.888***************9998 PP
Or compare P0A8W5 to CDD or PaperBLAST