PaperBLAST – Find papers about a protein or its homologs

 

Align P0C5J1 to PF14904 (FAM86)

P0C5J1 has 330 amino acids

Query:       FAM86  [M=94]
Accession:   PF14904.11
Description: Family of unknown function
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.3e-49  150.3   0.2    9.9e-49  149.7   0.2    1.3  1  P0C5J1    


Domain annotation for each sequence (and alignments):
>> P0C5J1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.7   0.2   9.9e-49   9.9e-49       2      93 ..       7      98 ..       6      99 .. 0.97

  Alignments for each domain:
  == domain 1  score: 149.7 bits;  conditional E-value: 9.9e-49
   FAM86  2 aeaeellkeferrFlamrrlesfPwqaleeeLkeskssellkeilkktvkHplckkfppsvkyrrlfLseLikkhEaakvepLdelYealae 93
            a++e ll+ ferrFla+r+l+sfPwq+le +L++s++sell++il+ktv+Hp+c+k+ppsvky+++fLseLikkhEa+++epLd+lYe+lae
  P0C5J1  7 AGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVCVKHPPSVKYAWCFLSELIKKHEAVHTEPLDKLYEVLAE 98
            568899*************************************************************************************9 PP



Or compare P0C5J1 to CDD or PaperBLAST