PaperBLAST – Find papers about a protein or its homologs

 

Align P23587 to PF17496 (DUF5431)

P23587 has 70 amino acids

Query:       DUF5431  [M=70]
Accession:   PF17496.6
Description: Family of unknown function (DUF5431)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-45  140.0   0.2    1.2e-45  139.9   0.2    1.0  1  P23587    


Domain annotation for each sequence (and alignments):
>> P23587  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  139.9   0.2   1.2e-45   1.2e-45       1      70 []       1      70 []       1      70 [] 0.99

  Alignments for each domain:
  == domain 1  score: 139.9 bits;  conditional E-value: 1.2e-45
  DUF5431  1 mseqhqdsLLprvaqGeegHEtaaKrpyLvcinrvlhvvniHvsDpkiavRdpaerRrqGGygktGLRir 70
             ms++hqdsLLpr+aqGeegHEt++K+p+Lvc++rv+h+v+iH+sD+kiavRd+++rR+qGG+g++GLRir
   P23587  1 MSSPHQDSLLPRFAQGEEGHETTTKFPCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRTQGGGGFHGLRIR 70
             9********************************************************************8 PP



Or compare P23587 to CDD or PaperBLAST