P32437 has 217 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-23 67.2 0.2 4.7e-23 67.2 0.2 1.9 2 P32437
Domain annotation for each sequence (and alignments):
>> P32437
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.0 0.2 0.18 0.18 39 49 .. 33 43 .. 32 44 .. 0.84
2 ! 67.2 0.2 4.7e-23 4.7e-23 3 56 .] 142 195 .. 140 195 .. 0.98
Alignments for each domain:
== domain 1 score: -2.0 bits; conditional E-value: 0.18
DUF1949 39 eeeveafkqaL 49
e+e+++f+q++
P32437 33 EQEAQEFIQKI 43
678999*9998 PP
== domain 2 score: 67.2 bits; conditional E-value: 4.7e-23
DUF1949 3 cdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
dY++lgk++++L+++++ +++++Y+++V+++ +v+e e af++++telt+G+
P32437 142 ADYTWLGKIENELRESQFLLKEIHYSENVEFETYVEEKETNAFSEWMTELTNGK 195
7****************************************************7 PP
Or compare P32437 to CDD or PaperBLAST