P36434 has 141 amino acids
Query: DUF559 [M=109] Accession: PF04480.16 Description: Protein of unknown function (DUF559) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-09 22.2 0.1 1.4e-08 20.9 0.0 1.6 2 P36434 Domain annotation for each sequence (and alignments): >> P36434 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.14 0.14 48 64 .. 52 68 .. 29 87 .. 0.64 2 ! 20.9 0.0 1.4e-08 1.4e-08 66 108 .. 93 135 .. 88 136 .. 0.90 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.14 DUF559 48 fvclkaklivelDGaqh 64 ++ k+ + +DG P36434 52 LSFKRYKIAIFIDGEFW 68 44455666666777654 PP == domain 2 score: 20.9 bits; conditional E-value: 1.4e-08 DUF559 66 eeeeyDaeRtelLeslGftvlRfkndevlknieevleeilkal 108 ++ ++D++ + +L s G+ ++Rf+ ++vlkn+e+ ei+ka+ P36434 93 HNMNRDKKVNDYLISNGWVIFRFWGKDVLKNPEKFSLEIQKAI 135 447899999***************************9999876 PP
Or compare P36434 to CDD or PaperBLAST