PaperBLAST – Find papers about a protein or its homologs

 

Align P39390 to PF06568 (DUF1127)

P39390 has 54 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.2e-18   52.1   8.5    2.8e-18   51.8   8.5    1.2  1  P39390    


Domain annotation for each sequence (and alignments):
>> P39390  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.8   8.5   2.8e-18   2.8e-18       1      37 []      18      54 .]      18      54 .] 0.97

  Alignments for each domain:
  == domain 1  score: 51.8 bits;  conditional E-value: 2.8e-18
  DUF1127  1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
             l++a+rrWrr  +trr L+++sD+ L+DIGL+R+d++
   P39390 18 LWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE 54
             8**********************************86 PP



Or compare P39390 to CDD or PaperBLAST