PaperBLAST – Find papers about a protein or its homologs

 

Align P43600 to PF20521 (DUF6736)

P43600 has 232 amino acids

Query:       DUF6736  [M=129]
Accession:   PF20521.3
Description: Family of unknown function (DUF6736)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.3e-13   35.1   0.0    9.4e-13   34.6   0.0    1.3  1  P43600    


Domain annotation for each sequence (and alignments):
>> P43600  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.6   0.0   9.4e-13   9.4e-13      42     120 ..     131     208 ..     104     213 .. 0.91

  Alignments for each domain:
  == domain 1  score: 34.6 bits;  conditional E-value: 9.4e-13
  DUF6736  42 liksksdansCtttsGtaegvkyaykatgknCdTtAekkTiqgAiekllkevekkkvceteClelsHgGtweGylrlga 120
               i  + +  +C+ + G +  + y+y+  + nC+ t ++kTi  A++++ ++++     +   ++++ gG w+G + +g 
   P43600 131 DIFGMTNMGNCAVMAGDKGAFYYKYYPVEPNCNSTIHQKTIDDALQQATEQLN-GDFNNMYFFHVNRGGLWQGDMMVGT 208
              67889999*******************************************98.5666699**************9997 PP



Or compare P43600 to CDD or PaperBLAST