P43902 has 377 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-26 79.3 1.5 3.9e-26 77.6 1.3 2.0 2 P43902
Domain annotation for each sequence (and alignments):
>> P43902
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.6 1.3 3.9e-26 3.9e-26 1 78 [. 11 88 .. 11 89 .. 0.98
2 ? -3.2 0.0 0.62 0.62 39 52 .. 223 237 .. 222 257 .. 0.70
Alignments for each domain:
== domain 1 score: 77.6 bits; conditional E-value: 3.9e-26
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+eId++Drel++L+a+R+el+ +++++K+++glp++ peRe ++l+ +r +ae++g++++++e+++r+ ++es a +
P43902 11 RSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYAPEREIAMLQARRLEAEKAGISADLIEDVLRRFMRESYANE 88
99************************************************************************9977 PP
== domain 2 score: -3.2 bits; conditional E-value: 0.62
CM_2 39 peReeevlerlre.g 52
peR e +le+++ g
P43902 223 PERYEWLLEQIQIwG 237
788888888887643 PP
Or compare P43902 to CDD or PaperBLAST