P43902 has 377 amino acids
Query: PDH_N [M=154] Accession: PF02153.21 Description: Prephenate dehydrogenase, nucleotide-binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-17 49.9 0.0 2.2e-17 49.2 0.0 1.4 1 P43902 Domain annotation for each sequence (and alignments): >> P43902 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.0 2.2e-17 2.2e-17 42 108 .. 141 206 .. 117 239 .. 0.89 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 2.2e-17 PDH_N 42 avkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGte 108 + +ad+v+++vP++ +le+++ l+p l e++l+ D++svK ++ ++ ++ + g hPm+G + P43902 141 ILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHT-GAVLGLHPMFGAD 206 56799**************************************9999988888.799********94 PP
Or compare P43902 to CDD or PaperBLAST