PaperBLAST – Find papers about a protein or its homologs

 

Align P43902 to PF02153 (PDH_N)

P43902 has 377 amino acids

Query:       PDH_N  [M=154]
Accession:   PF02153.23
Description: Prephenate dehydrogenase, nucleotide-binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.3e-17   49.9   0.0    2.2e-17   49.2   0.0    1.4  1  P43902    


Domain annotation for each sequence (and alignments):
>> P43902  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   49.2   0.0   2.2e-17   2.2e-17      42     108 ..     141     206 ..     117     239 .. 0.89

  Alignments for each domain:
  == domain 1  score: 49.2 bits;  conditional E-value: 2.2e-17
   PDH_N  42 avkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGte 108
              + +ad+v+++vP++ +le+++ l+p l e++l+ D++svK ++  ++ ++     + g hPm+G +
  P43902 141 ILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHT-GAVLGLHPMFGAD 206
             56799**************************************9999988888.799********94 PP



Or compare P43902 to CDD or PaperBLAST