P44842 has 206 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-17 49.6 0.0 2.5e-17 48.9 0.0 1.4 1 P44842
Domain annotation for each sequence (and alignments):
>> P44842
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 48.9 0.0 2.5e-17 2.5e-17 1 56 [] 141 196 .. 141 196 .. 0.98
Alignments for each domain:
== domain 1 score: 48.9 bits; conditional E-value: 2.5e-17
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
l cdY ql ++q l+e+++++il++ ++++++l++ + e +eaf+++Lte +sGr
P44842 141 LDCDYGQLRLVQQLCEKYQVEILSQGFQANIHLILGISEKTIEAFSSELTEKSSGR 196
57*****************************************************8 PP
Or compare P44842 to CDD or PaperBLAST